- GPR137C Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85024
- Unconjugated
- Immunohistochemistry, Immunohistochemistry-Paraffin
- TM7SF1L2
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: RAQRLNQNLA PAGMINSHSY SSRAYFFDNP RRYDSDDDLP RLGSSREGSL PNSQSLGWYG TMTGCGSSSY TVTPHLNGPM TDTAP
- Rabbit
- 0.1 ml (also 25ul)
- GPR137C
- PBS (pH 7.2) and 40% Glycerol
- G protein-coupled receptor 137C
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
RAQRLNQNLAPAGMINSHSYSSRAYFFDNPRRYDSDDDLPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAP
Specifications/Features
Available conjugates: Unconjugated